PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G039500.1
Common NamePOPTR_0007s11460g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family LBD
Protein Properties Length: 287aa    MW: 31827.9 Da    PI: 6.9843
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G039500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.34.7e-4271061100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC+++Cv+apyfp +qp+kfa vhk+FGasnv kll++l+  +reda++sl+yeAe r+rdPvyG+vg+i+ lq++l+ql+
  Potri.007G039500.1   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFASVHKVFGASNVAKLLNELNAAQREDAVNSLAYEAEERLRDPVYGCVGLISILQHRLKQLQ 97 
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ++l  +k+e
  Potri.007G039500.1  98 NDLYCAKKE 106
                         **9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.4556107IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-427103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFASVH KVFGASNVAK LLNELNAAQR  60
EDAVNSLAYE AEERLRDPVY GCVGLISILQ HRLKQLQNDL YCAKKELANY IGPQAMLPMV  120
MQPQHMGNPS SSTVMQHSVM PMMGIPSVGQ MGMRAEAHQH QNHHVHPQQL YEAQQLAAVV  180
AAREQEILRA YEQQQQQHHQ QEIVRFNGGL EPANSVSDTG YNQINPSAAM PSSLALGTFD  240
NTFQIQPQGE PHPNQLQAQV LLQPQQIQQH PKSESEEGRR SVGPSC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.123330.0bud| catkin
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002310159.20.0hypothetical protein POPTR_0007s11460g
SwissprotQ9FKZ37e-89LBD36_ARATH; LOB domain-containing protein 36
TrEMBLB9HE740.0B9HE74_POPTR; Uncharacterized protein
STRINGPOPTR_0007s11460.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-85ASYMMETRIC LEAVES 2-like 1